Consultant - Fire & Life Safety

2.0 - 5.0 years

8.0 - 12.0 Lacs P.A.

Noida, Mumbai, Bengaluru

Posted:6 days ago| Platform: Naukri logo

Apply Now

Skills Required

softwaresimulationbimcaddbmsautocadreport writingsqljclsafetywritingfiredynamiccommunication skillsnavisworksmainframespathfinderadvantagefire safetypresentation skillsverbal communicationphotoshopsafety engineeringenvironmentcobolms office suite

Work Mode

Work from Office

Job Type

Full Time

Job Description

SPECIALIST Services – Fire and Smoke Control Modelling Engineer (Fire Engineering) The Fire and Smoke Control Modelling Consultant is responsible for undertake Computational Fluid Dynamic (CFD) modelling of spaces within structures (buildings/ tunnels) where active smoke control is required. The role requires an individual who is familiar with computer modelling tasks, who can build 1D or 3D models of the space, undertake CFD modelling and report back finding. The individual should be comfortable to engage with various design disciplines to obtain the information required to undertake this analysis. They should have excellent communication skills. In addition, they should be able to present ideas/ topics within the 3D domain and assist in developing graphics for deliverables. The engineer will be part of a wider multidisciplinary design team to deliver a design with the support of the wider fire and life safety team. A hands-on approach and excellent communicate skills, verbal and written are essential. Excellent report writing skills are also required. Key Responsibilities: Develop and conduct fire and smoke control simulations using CFD software. Analyse fire dynamics and smoke movement in buildings and other structures. Skilled in clearly communicating analysis findings to ensure they are easily understood by all stakeholders. Collaborate with internal and external project stakeholders to communicate the CFD results and anticipated deliverables. Create comprehensive technical reports and presentations for clients and authorities. Develop high-quality technical report under the supervision of senior members. Able to undertake research on specific issues and suggest potential solutions. Communicate design requirement in a timely manner with the multidisciplinary design team. Ensure compliance to QMS policies and procedures. Project Leadership: Able to manage the fire modelling of a project and meet project deadlines. Ensure regulatory requirements are met. Ensure project programs are met and advise on any foreseen delays Participate and support internal multi-discipline knowledge sharing initiatives. Mandatory skills English language communication skill, written and verbal is critical. Excellent report writing skills. Skills in modelling tools: Fire Dynamic Simulator Smokeview Pyrosim NAVISworks Subway Environmental Simulation IDA software Photoshop Pathfinder, CONTAM and Ansis is an advantage Excellent presentation skills. Qualifications Ideal candidate will come from a fire safety engineering / mechanical engineering background. Degree in Fire Safety Engineering from an accredited education establishment would be advantageous. Minimum 3 years' experience in the field of fire modelling. Experience of MS Office Suite of Programs. Experience with BIM and AutoCAD is an advantage.

Engineering, Consulting
Montreal

RecommendedJobs for You