Deputy Manager

0 years

0.0 Lacs P.A.

Chennai, Tamil Nadu, India

Posted:2 weeks ago| Platform: Linkedin logo

Apply Now

Skills Required

designresearchdevelopmentcollaborationleadershiparchitectureevaluationdimensioningdfmeaanalysiscadcostingprototypetestingengineeringmarketingdrawingdocumentationverificationteststackgd&t

Work Mode

On-site

Job Type

Full Time

Job Description

About The Role We are looking for a creative and technically skilled Design Engineer to join our Research & Development (R&D) team. The ideal candidate will be responsible for the design and development of innovative products and systems, supporting both new product development (NPD) and improvement of existing products. This is a hands-on role that requires strong technical knowledge, design thinking, problem-solving skills, and cross-functional collaboration The Impact You’ll Make To take technical leadership role in delivering the product as per the specified requirements and within the target cost, time, quality and performance. To define the technical product concept / product architecture (technical solutions, modules and interfaces, also called conceptual design) taking into account all relevant requirements from industrial design, development and supply chain. To define the evaluation criteria, evaluates the concepts and documents both the progress as well as the final concept choice. Also accountable for the concept quality referring to the robustness and proper dimensioning and balancing of the implemented solutions. Responsible for quality of main design in the aspect of feasibility and robustness measured with attendant quality tools. e.g. DFMEA, PFMEA, tolerance analysis, DFA, DFS, CTQ. To create CAD design from the aesthetics input and deliver 3D and 2D Drawings at different stage of project as per the project need. To create and deliver the product BOM for costing and production purpose The Skills And Knowledge You’ll Bring Domestic appliance/consumer durable domain knowledge, DFSS/GB or BB preferred. Product Design & Development, Prototype Development/Testing exposure. Exposure and practice to Architecture / System engineering. BIS related to home appliance products / IEC. Patent procedures and exposure. Strength of materials- Material selection knowledge in min two of these- Plastics, S.S., Alloys & Rubber. Machine design knowledge. Good in Conceptualization and Ideation considering the requirements of Marketing/Consumer. The incumbent should be a graduate in Mechanical Engineering. He/she should have minimum 5 years of experience End to End product design experience (Preferably from Kitchen / home appliances vertical), CAD – Modelling & drawing, Creation of bill of materials, Design documentation like DFMEA etc., Reverse Engineering, Verification & Validation test plan knowledge, Tolerance stack up, GD&T knowledge. Ready to make an impact? From developing game-changing air fryers to perfecting the art of coffee making, Versuni’s purpose is turning houses into homes — and we’re calling on your talent to bring it to life. Join our global team of 6,000+ passionate individuals, work with world-class brands, and shape the future of home living. We’re ready for you — are you ready for us? 7145 Show more Show less

RecommendedJobs for You

Pune, Maharashtra, India

Chennai, Tamil Nadu, India

Mumbai, Maharashtra, India

Abdasa, Gujarat, India