Sales Account Manager

12.0 years

0.0 Lacs P.A.

Navi Mumbai, Maharashtra, India

Posted:1 week ago| Platform: Linkedin logo

Apply Now

Skills Required

portfolioonboardingpipelinedriveservicemanagementstrategypricingresearchmarketingnegotiationdraftingplanningtrackingmetricswritingtimelinecuttingtechnologyconsultingnetworkingdatasecuritysupportcollaborationciscojuniper

Work Mode

On-site

Job Type

Full Time

Job Description

Summary : The Sales Account Manager is responsible for building and managing a portfolio of IT infrastructure and managed services clients. The ideal candidate will have a proven track record of success in selling IT solutions to enterprise customers. This is a mix of hunting (40%) & farming (60%) role Role Description Responsible for onboarding new logos and manage & maintain a healthy NN (Net New) sales pipeline for accounts and grow new logos to sizeable revenues Primary client-facing field representative; to own, drive the continuity and profitability of NN revenues Job Specifications & Requirements Minimum 12+ years’ experience, with at least 5 years’ experience in Sales in the IT-sector Well networked with customer organizations Experience of handling larger outsourcing engagements within the IT-Service industry (pre-sales or sales phase) Proven track record of sales successes Project Management experience Willingness to travel Open, communicative and team-oriented Self-reliant and compelling Analytic and conceptual frame of mind Goal oriented, resilient Key Responsibilities Lead generation and onboarding new logos Collaborate with Vertical Leaders, Practitioner Sales, Client Delivery Leads to identify services/ offerings / value proposition to take to the customer based on client requirement Forge relationships with buying offices of potential client, gather relevant vertical and market knowledge Learn, know and bring the best of Black Box to customer (offerings, use cases, etc.) Define overall pursuit strategy incorporating feedback from past customer experience; develop client proposal and pricing along with bid manager and Solution Architects Generate leads through secondary research and pursue leads identified by marketing teams and leaders Drive leads to closure Own actual negotiation; also coordinate inputs / participation from different stakeholders Develop negotiation strategy & negotiate contract / agreement; oversee bid manager in drafting SoW for contract; participate in win/loss review Collate & communicate learnings from pitches, proposals, customer feedback to Sales team Oversee account handover to Vertical AM Identify customer needs and facilitate account setup to commence delivery operations along with the Client Delivery Lead/Delivery Manager Create robust transition plan for account handover to Vertical AM Coordinate and act as conduit for overall delivery and operational excellence for the account including financial planning & tracking Coordinate with Delivery team to ensure high quality delivery – conduct joint discussions for implementation, delivery and contractual obligations Own cost metrics for an account - with inputs from Client Delivery Managers of individual projects Identify margin improvement initiatives and coordinate with Delivery Managers/ PMs to execute and implement these initiatives Key Interfaces Collaborate with Bid Manager/proposal team for proposal writing Collaborate with Practitioner Sales to identify services/ offerings/value proposition to take to the customer based on client requirement & with bid manager to draft RFI response Work with Sales Ops team to create a repository of leads, clients, buying offices, reason for drop-outs etc. Orchestrate account performance reviews, status update, timeline adherence, SLA adherence etc. along with Client Delivery Manager Key Metrics KPIs Revenue Order book % gross margin delivered Pipeline size New logos won (# of logos, INR) Client satisfaction (CSAT) KRAs As-sold margins Number of new deals : Win rate / close rate Lead mortality rate % Variance in forecasted Vs. actual rev. % Variance in forecasted Vs. actual GM This job description is designed to cover or contain a comprehensive listing of activities, duties, and responsibilities that are required of the employee; it is not meant to be all-inclusive for any one position. Job responsibilities and requirements are subject to change at any time due to business conditions or any other reason. Company Profile : Black Box is a trusted IT solutions provider delivering cutting-edge technology solutions and world-class consulting services in Unified Communications, Enterprise Networking, Data Center, Digital Applications and Cyber Security. We deliver solutions, services and products to more than 8,000 clients worldwide. These clients trust our 4000+ team members in 35+ countries who for over 45 years have been connecting people, technology, and ideas to help accelerate their digital transformation. Satisfied clients, including 100+ in the Fortune 500, count on our global team members who operate across 75 support centers, to drive their business innovation. In collaboration with global technology leaders like Avaya, Aruba, Cisco, Commscope, Corning, Extreme, Fortinet, Genesys, HPE, Juniper, Mitel, Nutanix, Palo Alto, Poly, Trend Micro, UiPath and Verint among others, Black Box delivers domain focused, flexible, and customized technology solutions and seamless services that accelerate customers’ business. Corporate Website: www.blackbox.com *Only relevant applications will be processed Show more Show less

Information Technology & Services
Lawrence

RecommendedJobs for You

Navi Mumbai, Maharashtra, India

Chennai, Tamil Nadu, India

Noida, Uttar Pradesh, India